Loading...
Statistics
Advertisement

Studentfly.eu

Advertisement
Conversion Technology Metas Server
Studentfly.eu is hosted in Germany . Studentfly.eu doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Studentfly.eu

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Studentfly.eu

Missing HTTPS protocol.

    Meta - Studentfly.eu

    Number of occurences: 1
    • Name:
      Content: 0;url=defaultsite

    Server / Hosting

    • IP: 217.160.223.138
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns55.1und1.de
    • ns56.1und1.de
    • mx00.kundenserver.de
    • mx01.kundenserver.de

    Target

    • hostmaster.1und1.de

    HTTP Header Response

    HTTP/1.1 200 OK Date: Fri, 13 May 2016 17:11:32 GMT Server: Apache Last-Modified: Mon, 30 Jan 2012 15:10:49 GMT ETag: "fae3e6b1-e5-4b7c0406eeeae" Accept-Ranges: bytes Content-Length: 229 Content-Type: text/html X-Cache: MISS from s_lu10 X-Cache-Lookup: MISS from s_lu10:80 Via: 1.1 s_lu10 (squid/3.5.12) Connection: keep-alive

    DNS

    host: studentfly.eu
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.160.223.138
    host: studentfly.eu
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns55.1und1.de
    host: studentfly.eu
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns56.1und1.de
    host: studentfly.eu
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns55.1und1.de
    5. rname: hostmaster.1und1.de
    6. serial: 2016042900
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: studentfly.eu
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.kundenserver.de
    host: studentfly.eu
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.kundenserver.de

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tudentfly.eu, www.setudentfly.eu, www.etudentfly.eu, www.swtudentfly.eu, www.wtudentfly.eu, www.sdtudentfly.eu, www.dtudentfly.eu, www.sxtudentfly.eu, www.xtudentfly.eu, www.sftudentfly.eu, www.ftudentfly.eu, www.sgtudentfly.eu, www.gtudentfly.eu, www.sttudentfly.eu, www.ttudentfly.eu, www.sudentfly.eu, www.stqudentfly.eu, www.squdentfly.eu, www.staudentfly.eu, www.saudentfly.eu, www.st udentfly.eu, www.s udentfly.eu, www.stwudentfly.eu, www.swudentfly.eu, www.steudentfly.eu, www.seudentfly.eu, www.stzudentfly.eu, www.szudentfly.eu, www.stxudentfly.eu, www.sxudentfly.eu, www.stcudentfly.eu, www.scudentfly.eu, www.stdentfly.eu, www.stuwdentfly.eu, www.stwdentfly.eu, www.stuedentfly.eu, www.stedentfly.eu, www.stusdentfly.eu, www.stsdentfly.eu, www.stuadentfly.eu, www.stadentfly.eu, www.stuentfly.eu, www.studtentfly.eu, www.stutentfly.eu, www.studgentfly.eu, www.stugentfly.eu, www.studbentfly.eu, www.stubentfly.eu, www.studxentfly.eu, www.stuxentfly.eu, www.studsentfly.eu, www.stusentfly.eu, www.studfentfly.eu, www.stufentfly.eu, www.studventfly.eu, www.stuventfly.eu, www.studyentfly.eu, www.stuyentfly.eu, www.studzentfly.eu, www.stuzentfly.eu, www.studaentfly.eu, www.stuaentfly.eu, www.studeentfly.eu, www.stueentfly.eu, www.studrentfly.eu, www.sturentfly.eu, www.studntfly.eu, www.studexntfly.eu, www.studxntfly.eu, www.studesntfly.eu, www.studsntfly.eu, www.studewntfly.eu, www.studwntfly.eu, www.studerntfly.eu, www.studrntfly.eu, www.studefntfly.eu, www.studfntfly.eu, www.studevntfly.eu, www.studvntfly.eu, www.studecntfly.eu, www.studcntfly.eu, www.studeqntfly.eu, www.studqntfly.eu, www.studeantfly.eu, www.studantfly.eu, www.studeyntfly.eu, www.studyntfly.eu, www.studetfly.eu, www.studenntfly.eu, www.studentfly.eu, www.studenhtfly.eu, www.studehtfly.eu, www.studenjtfly.eu, www.studejtfly.eu, www.studenktfly.eu, www.studektfly.eu, www.studenltfly.eu, www.studeltfly.eu, www.studen tfly.eu, www.stude tfly.eu, www.studenfly.eu, www.studentqfly.eu, www.studenqfly.eu, www.studentafly.eu, www.studenafly.eu, www.student fly.eu, www.studen fly.eu, www.studentwfly.eu, www.studenwfly.eu, www.studentefly.eu, www.studenefly.eu, www.studentzfly.eu, www.studenzfly.eu, www.studentxfly.eu, www.studenxfly.eu, www.studentcfly.eu, www.studencfly.eu, www.studently.eu, www.studentfqly.eu, www.studentqly.eu, www.studentfly.eu, www.studently.eu, www.studentfaly.eu, www.studentaly.eu, www.studentfyly.eu, www.studentyly.eu, www.studentftly.eu, www.studenttly.eu, www.studentfgly.eu, www.studentgly.eu, www.studentfbly.eu, www.studentbly.eu, www.studentfwly.eu, www.studentwly.eu, www.studentfsly.eu, www.studentsly.eu, www.studentfdly.eu, www.studentdly.eu, www.studentfrly.eu, www.studentrly.eu, www.studentf3ly.eu, www.student3ly.eu, www.studentf4ly.eu, www.student4ly.eu, www.studentfy.eu, www.studentfluy.eu, www.studentfuy.eu, www.studentfl8y.eu, www.studentf8y.eu, www.studentfl9y.eu, www.studentf9y.eu, www.studentfljy.eu, www.studentfjy.eu, www.studentfl0y.eu, www.studentf0y.eu, www.studentflmy.eu, www.studentfmy.eu, www.studentflpy.eu, www.studentfpy.eu, www.studentfloy.eu, www.studentfoy.eu,

    Other websites we recently analyzed

    1. DPMCUSA | Best Credit Repair | New York | New Jersey | Pennsylvania
      Best Credit Repair Serving New York Buffalo Albany Jersey City Newark Pittsburgh & Philadelphia. Services Nationwide. Get the Best Results. A+ Rating.
      Burlington (United States) - 66.96.161.132
      Server software: Apache/2
      Technology: CSS, Google Font API, Javascript
      Number of Javascript: 3
      Number of meta tags: 5
    2. Willkommen bei PPE-Trading
      Zurich (Switzerland) - 217.26.52.41
      Server software: Apache/2.4
      Technology: CSS, Html
      Number of meta tags: 10
    3. J Collins Kerr | www.jcollinskerr.com | Home
      Beaverton (United States) - 67.51.200.171
      Server software:
      Technology: CSS, Html, Javascript, jQuery UI, Share This Social Media Buttons
      Number of Javascript: 9
      Number of meta tags: 3
    4. valentinesdaywishesmessagespics.com
      Scottsdale (United States) - 104.238.72.112
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    5. Kumruoğlu Nakliyat Lojistik Ambarcılık - www.kumruoglu.com.tr
      Kumruoğlu Nakliyat Lojistik Ambarcılık
      Turkey - 94.73.147.80
      Server software: nginx/1.1.19
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI
      Number of Javascript: 21
      Number of meta tags: 2
    6. giovannimurray.com
      Wayne (United States) - 74.208.165.84
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    7. W-Didacte.be
      Denmark - 46.30.212.21
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    8. your-coaching-concept.net
      Hier entsteht
      Germany - 89.31.143.16
      Server software: Apache
      Technology: CSS, Html, SVG
      Number of meta tags: 3
    9. express-airports.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    10. novosconfidentes.com.br
      Porto Alegre (Brazil) - 189.38.86.41
      Server software: Apache
      Technology: Html

    Check Other Websites